CDS

Accession Number TCMCG047C03155
gbkey CDS
Protein Id GFP81720.1
Location complement(join(2463537..2463563,2463716..2463806,2464095..2464260,2464364..2464391))
Organism Phtheirospermum japonicum
locus_tag PHJA_000315300

Protein

Length 103aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJDB3858 BioSample:SAMD00029051
db_source BMAC01000033.1
Definition mRNA turnover protein 4 homolog [Phtheirospermum japonicum]
Locus_tag PHJA_000315300

EGGNOG-MAPPER Annotation

COG_category A
Description Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03009        [VIEW IN KEGG]
KEGG_ko ko:K14815        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000027        [VIEW IN EMBL-EBI]
GO:0000956        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005730        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006364        [VIEW IN EMBL-EBI]
GO:0006396        [VIEW IN EMBL-EBI]
GO:0006401        [VIEW IN EMBL-EBI]
GO:0006402        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009056        [VIEW IN EMBL-EBI]
GO:0009057        [VIEW IN EMBL-EBI]
GO:0009892        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010605        [VIEW IN EMBL-EBI]
GO:0010629        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016070        [VIEW IN EMBL-EBI]
GO:0016071        [VIEW IN EMBL-EBI]
GO:0016072        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0019439        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0022618        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0034470        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034655        [VIEW IN EMBL-EBI]
GO:0034660        [VIEW IN EMBL-EBI]
GO:0042254        [VIEW IN EMBL-EBI]
GO:0042255        [VIEW IN EMBL-EBI]
GO:0042273        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044248        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044265        [VIEW IN EMBL-EBI]
GO:0044270        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0046700        [VIEW IN EMBL-EBI]
GO:0048519        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070925        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071826        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901361        [VIEW IN EMBL-EBI]
GO:1901575        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGCCAAAATCAAAGCGCGACAGACCAGTGACTCTATTGAAGACAAAGAAGAAAGGAAGGGCGCATAAAGAAATTGTGGTGAACTCGATACAAGATTCTGTGGAGAAGTACGATTCGGTCTACGTTTTCACTTTTGAAAACATGAGGAATCTCAAGTTCAAGAAATTCAGAGACCGGCTCAAGTCCTCAAGTAGATTTTTTCTAGGGTCGAACAAGGTTATGCAGATTGCCTTAGGTAGGTCTGATGCTGATGAGATCAAATCGGGCCTTCACAAGATCTCAAAGCTTCTGTGTGGAGATTCAGGGCTTTGA
Protein:  
MPKSKRDRPVTLLKTKKKGRAHKEIVVNSIQDSVEKYDSVYVFTFENMRNLKFKKFRDRLKSSSRFFLGSNKVMQIALGRSDADEIKSGLHKISKLLCGDSGL